DPCstruct | MC14013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 283 ± 47 aa |
| Standard deviation of domain lengths | 47.10 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R8Q8J7 | 1-323 | MPGMVLFRRRWSVGSDDLVLPAFFLFVLHCIWLVVLSVVLFGLPYSSEQSCSVTLVDHGRGYLGILVSCLICESAIMWLSMRGSILY… |
| A0A6S7JR12 | 7-317 | FNRRWVVGSDDFVIPFGIAFVLRVIWMISLGVVLALYHSFDYDPYTASNFPYYECQSTFDYFTSGYIVLLFATNLLEFLVSWLSSKG… |
| A0A6H5IBC1 | 176-431 | None |
| C1FDN2 | 1-392 | None |
| A0A836B832 | 1-272 | None |
| A0A0V1DF00 | 1-289 | None |
| K1PNC0 | 44-399 | None |
| A0A0R3T575 | 1-254 | None |
| A0A564Y478 | 1-252 | None |
| A0A1B6CRZ8 | 7-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.