DPCstruct | MC14012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 118 ± 17 aa |
| Standard deviation of domain lengths | 16.75 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z0PTP9 | 259-380 | DEIAHYYRFQQLEKGRYYQKGDEPGSPSGPELHVDWSAVYPVKPDLKLEHLAEDPHILAAAKEFNEFYAAFLAKINLAYKGQPNLLL… |
| A0A6S7JGK7 | 55-164 | GKNADTFAYIGKSLPFDEDGVWPIVDNPMMSMYKDGTRAQHVAKSFSKTYWKLLEKLQNVFDGNTLLFGDTVAIMKDLLIHGNRLVQ… |
| A0A345T4E4 | 82-189 | None |
| A0A3D9W6L6 | 1-146 | None |
| A0A512BGS5 | 12-112 | None |
| A0A1N7KT25 | 342-484 | None |
| Q7USV4 | 245-365 | None |
| A0A846CVX3 | 39-192 | None |
| A0A7U4P7D2 | 135-262 | None |
| A0A090KQ49 | 237-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.