DPCstruct | MC14010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 47 ± 2 aa |
| Standard deviation of domain lengths | 2.02 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 78.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 73.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04502 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1ITA7 | 1-45 | MGERKGVNKYYPPDYRPEKGSLNKYHGTHALRERARKLDQGILII |
| A0A6S7J8W4 | 1-46 | MAERKQVNKYYPPDWDPSKGSVNKHVGQHPLHERARKHSQGILIIS |
| A0A1R0H310 | 1-50 | None |
| A0A0F8CT46 | 1-46 | None |
| A0A820KPE1 | 1-50 | None |
| A0A6I9Y930 | 1-46 | None |
| A0A2R7X9B8 | 1-45 | None |
| A0A1R1YL94 | 1-45 | None |
| A0A212D0I2 | 44-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.