DPCstruct | MC1401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 132 ± 9 aa |
| Standard deviation of domain lengths | 9.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 26.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V3R9Y1 | 4-137 | EMKIDSADGLVSWCRSVGSEVKLQRKGAGIIMDYLSENGKKLSSSSEGKLFFSDYAMSEPTTIDDVVDLVCEWNYEKLSDIRDKKEN… |
| A0A373LF38 | 4-141 | ENEVFTKAEELIEWLDENDILMNLTDKEAGVLISYMEAHGYGIGVRENRLVRIDITETENIVEDYSIDDVIDSVFDWNYELITEADK… |
| R9IGB8 | 1-138 | None |
| A0A239R2A1 | 1-142 | None |
| A0A415LHA4 | 2-127 | None |
| R9INC6 | 104-237 | None |
| A0A3E5AKX3 | 3-129 | None |
| T4VI58 | 3-119 | None |
| A0A7U9S3E4 | 292-431 | None |
| A0A6L6XJ22 | 3-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.