DPCstruct | MC14007
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 77 ± 12 aa |
| Standard deviation of domain lengths | 12.18 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B2VH79 | 9-63 | PERRIELNPFDVDAWNLLLRESQARPIDQVRSFYEKLVTQFPNAGRYWKAYIDHE |
| A0A6S7IVK0 | 1-67 | MAYRSKSERGQKAEQRLLADPYDTESWNVLLREAQTLPIASGRQLYERLVDRFPTCGRYWRLYIEQE |
| K1PMJ9 | 7-83 | None |
| A0A131YXA2 | 3-91 | None |
| A0A2J8P3V8 | 1-84 | None |
| A0A6J0URE3 | 6-77 | None |
| A0A0H5S2R7 | 9-63 | None |
| D5ACS0 | 11-102 | None |
| E4Y2D8 | 2-72 | None |
| A0A803KET3 | 3-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.