DPCstruct | MC14006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 182 ± 17 aa |
| Standard deviation of domain lengths | 16.79 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05250 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0AM29 | 1-182 | MMKESKLTNFQQRHIMDTMKRGDPLPLQCSPASSQRVLPSKQPASAIYLPPIMAARSHLRPASKCQANGAYSREQFKPQATRDLEKE… |
| A0A6S7IMW6 | 29-214 | LLKVMMQESKLTNFQQRQLSDRLKGGDSFPTDVNPTSSARKEARNTSSAKSAGKARDGRQLTGAGKRSQADIEKRVANDEEDPYRPP… |
| A0A4X2K5X5 | 4-195 | None |
| A0A4W2CK47 | 69-255 | None |
| A0A3P8VT87 | 4-180 | None |
| A0A7J8FVY5 | 1-165 | None |
| A0A6F9D7G6 | 1-198 | None |
| A0A4Z2GWS9 | 1-147 | None |
| A0A556TTC7 | 360-539 | None |
| A0A6J2D2R9 | 3-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.