DPCstruct | MC14005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 137 ± 9 aa |
| Standard deviation of domain lengths | 9.23 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7IML9 | 16-155 | DTYHDTITGISQVFPLLDPKWIENEEIEFISYVPVPVNVNILKQTCNNVDETELQAWEDRANFINNDLKWLLCQSHSRFWNHVIFNK… |
| A0A341DCJ4 | 2-137 | PALPLDQLQITHKDLKTGKLRTSPALHPEQKADRYFVLYKPPPKDNIPALVEEYLERATFVANDLDWLLALPHDKFWCQVVFDETLQ… |
| F0ZHI1 | 60-215 | None |
| A0A132A564 | 1-133 | None |
| T1KUX0 | 33-170 | None |
| A0A6J0J9N1 | 2-116 | None |
| A0A5B7FMP0 | 60-191 | None |
| A0A817BXJ2 | 1-143 | None |
| A0A821VPL6 | 1-143 | None |
| A0A1I8GJS6 | 27-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.