DPCstruct | MC14004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 3.86 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 40.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F7IMP3 | 1-68 | MEKAYRNNCYRCGRERIVVKVWKEKVENSVIENTESICPDKKCQEVVDQEIRRQRNKHLQAENKRKEM |
| K2FRD5 | 2-63 | SKCPRCGKERVIVSSHDEMISKSKITYTQTICPDPECQKVVEKNLKNDEKKRAVLKDEQEKR |
| A0A1F5GG44 | 1-62 | None |
| A0A0G0DXG3 | 1-61 | None |
| A0A0G0W6X4 | 28-100 | None |
| A0A1G1WSE8 | 2-68 | None |
| A0A1F5HZ43 | 3-64 | None |
| A0A0G1CEJ6 | 1-62 | None |
| A0A1F5YYC9 | 7-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.