DPCstruct | MC14002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 116 ± 20 aa |
| Standard deviation of domain lengths | 20.21 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H5X2T3 | 14-120 | KEDRVNDKSFTQAPYEEIKNLFNSICVTLPKIKNIKGNRQKVVRQRWKENPDINFFKELFEKVNKSDFLSGRSGKWVGCSFDWIMQP… |
| A0A7V8JEI7 | 4-99 | CPYQAIVNLYHTALPELPVVAILNDTRKRSLQARWRESEIHRDLEFWADYFFQVKTSDFLMGRVPGRNGGKSFRATFDWLIAPSNFV… |
| A0A4D7JID1 | 177-302 | None |
| R9KUM7 | 67-226 | None |
| A0A2V4DZI9 | 151-247 | None |
| A0A351RVT8 | 137-305 | None |
| A0A808U476 | 2-123 | None |
| A0A3M0CQY3 | 248-370 | None |
| A0A7X6I9Z3 | 118-248 | None |
| A0A1I7HAP8 | 54-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.