DPCstruct | MC1400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 378 ± 63 aa |
| Standard deviation of domain lengths | 63.44 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4MTN9 | 25-399 | SANDDYREVVNRVAEMVWDSKVTQMASEHGLDVVNVTWEDTGRYYGSCWGPNISDMTIQVHSYDDGAEYPTLTCMPVIRYPNFHDLS… |
| G2LLF5 | 7-389 | SKNPATSAPAPKLSPKEAAEYQRTIAATAGMVQDAQAIALAQKYGLDIVNLTWEDTGRYKNSAVGPNISDMTIQVGFEDPTTRQFQV… |
| A9UWE7 | 9-442 | None |
| X6PCT0 | 4-432 | None |
| A0A1Q9DEI8 | 12-455 | None |
| A0A1Q9CTS9 | 14-417 | None |
| A0A1V5QZS1 | 111-482 | None |
| A0A6G0XBG8 | 25-373 | None |
| A0A812P259 | 488-947 | None |
| A0A812QAW3 | 2-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.