DPCstruct | MC140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 131 ± 16 aa |
| Standard deviation of domain lengths | 16.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G7YWM5 | 263-379 | RVGGRWHGYRARWRDGEHDVLPELREGRWWVRLGDGTAVPAEECEELRFVTAVCEWAGAPFQVVDERDGELLLEYTGGRVSVARDLG… |
| A0A163G2R7 | 3-156 | EQPSIPENVTGGFIARSSGTWVQTSEGWFASTWAIAEGGPIQDLFVYDHEGMDSRQVPLATVISAEDVASEALYNGHWIPLVSMWND… |
| A0A4R9BK22 | 110-246 | None |
| F9EDG1 | 213-370 | None |
| D7N2P9 | 3-109 | None |
| A0A3D5DUM0 | 2-138 | None |
| A0A7K0C8P4 | 7-137 | None |
| A0A1R4FCB3 | 172-307 | None |
| W9AXB2 | 10-138 | None |
| A0A2S5X425 | 148-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.