DPCstruct | MC14
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 110 ± 12 aa |
| Standard deviation of domain lengths | 12.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 34.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09998 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B8BU11 | 3-111 | ETYTAFNGHTRITSAPRPELATLLAEQGHGPGAALLIFSDLTGRETDLDLSGGPEAVAARYTPAPRGRGRPKLGVVPREVTLLPRHW… |
| I5BR99 | 1-127 | MPGYTAFHGRKRLASGASIDVALAVKALLTEHPGADVLVFDDETGRQVDFNLSGSDAEVAARLSDGEPAKASAKRTPGRPKLGVVAR… |
| A0A7U1E5H4 | 4-106 | None |
| J8VNY7 | 1-107 | None |
| A0A378ZP78 | 8-132 | None |
| K6G9K9 | 122-232 | None |
| A0A7Y3JGK1 | 70-180 | None |
| A0A3D0MCC6 | 3-102 | None |
| A0A5C8ITY1 | 3-103 | None |
| A0A7J7AKP5 | 506-635 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.