DPCstruct | MC13999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 616 |
|---|---|
| Mean domain length (aa) | 173 ± 38 aa |
| Standard deviation of domain lengths | 38.26 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 15.00 |
| Pfam Score | 99.11 |
| Assigned Pfam label(s) | PF12631- CL0489- CL0063- CL0118- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843CL22 | 112-242 | VQAVSEIARTGAALIKDGDRILTHCNSKAALAPIIEAHRQGKKIEVYATESRPWRQGLLTIRDLAGAGVPVTLIIDSAVRRFMPDID… |
| A0A0W8FL13 | 5-167 | SLKDKNNIAKKAASIVAEGSSVILGAGIPTKCLKFLNDKDCWVIYETGIIGACPFTCGTETIIDASRKKIGLREGGSIFDSSFIFSL… |
| R9PMB7 | 7-243 | None |
| A0A350IWK3 | 22-152 | None |
| K8ELV9 | 97-227 | None |
| A0A370IFV3 | 336-560 | None |
| A0A7S3ZPL2 | 395-524 | None |
| A0A7V2XSJ5 | 123-284 | None |
| N4X2A1 | 704-908 | None |
| F4Q747 | 866-1075 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.