DPCstruct | MC13998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 160 ± 17 aa |
| Standard deviation of domain lengths | 17.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832J936 | 219-374 | LIKYIYNLIKKFSKTIEKVIVFNYKFYGNDFYAILFPGDGKFELIEAILPGSAYNLHYNFVIMGRDDESGGYYAAKLSFYELLNELG… |
| A0A0W8FJT5 | 25-172 | RLYGNLIVCLLVPGDWGFEMIEIWGRQSLWSGGDEVIVRDGERQTKSGYSPLAGAYYSARLGVAEHLEAIGRSARVLVLRSVSGDYW… |
| A0A7C1W2U2 | 129-304 | None |
| A0A662IJ93 | 45-220 | None |
| A0A2R6BVH5 | 245-425 | None |
| A0A832UNK8 | 113-284 | None |
| A0A7C4WHJ8 | 12-144 | None |
| A0A075WDX7 | 198-366 | None |
| B5I9I1 | 153-327 | None |
| A0A5E4IEF7 | 67-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.