DPCstruct | MC13995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 57 ± 3 aa |
| Standard deviation of domain lengths | 2.75 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 49.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A419WNP3 | 1-55 | MDECPRCQGSLEELSLGDVSTVSCPHCEYADIPVEHESVPETPESWRDALNRFYE |
| A0A1I3BJ46 | 27-87 | STRETVSTECPRCGSALTTFTLGGAEAVGCDACGYAGVEVDHSGEPRLVESWEEALERFGR |
| A0A2R6I7Y1 | 2-58 | None |
| A0A6B9F433 | 1-55 | None |
| V4XM53 | 38-99 | None |
| A0A1H3X597 | 1-56 | None |
| A0A4V5ZP53 | 1-55 | None |
| A0A830F3K3 | 3-63 | None |
| A0A6A9SZV0 | 1-58 | None |
| U1MV96 | 1-55 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.