DPCstruct | MC13993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 5.28 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 50.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645HT13 | 1-83 | MNEDAAAGMVANLANNIAMFNIFEKMDPKGKLLNVAFTVSAAFVFGDHLGFTAGANPEMIFPVVVGKLVAGITAVILANFLAP |
| A0A2G9MRE6 | 1-83 | MSSFGVAGIIASLANVIPMFAMFKDMKPREKIINVAFAVCAAFVLGDHLGFTAAVNASFITPVLVGKLAGGIFAFSLALFFTR |
| A0A2G1CNH8 | 38-120 | None |
| W1HXE5 | 86-178 | None |
| A0A2X2WAY8 | 63-149 | None |
| A0A376RF69 | 239-333 | None |
| A0A625T9U5 | 629-720 | None |
| A0A3S4P1G6 | 1-95 | None |
| A0A510L5R0 | 124-222 | None |
| A0A377WLX0 | 10-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.