DPCstruct | MC13992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 241 ± 25 aa |
| Standard deviation of domain lengths | 25.41 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 95.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 52.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378W5M0 | 2-247 | PGAVPAGIRAVAAENLIASAVDLECASGNDQSFSHSPMRRTARLLPQMMPGTDFITSGYSATPNYDNMFAGSNVDAEDFDDFNTIQR… |
| A0A2X4Z8M1 | 186-432 | VPSAVPSGIRAVLAENLICSSLDLECASSNDQTFTHSDMRRTARLLMQFLPGTDFISSGYSAVPNYDNMFAGSNEDAEDFDDYNVIQ… |
| A0A317RM29 | 306-550 | None |
| A0A1Q6XIP7 | 110-355 | None |
| A0A401FMY1 | 98-302 | None |
| A0A3L7W051 | 266-544 | None |
| A0A7R8WV17 | 1-266 | None |
| A0A7H4M707 | 1-181 | None |
| A0A645CJG5 | 39-284 | None |
| A0A6J7TT74 | 154-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.