DPCstruct | MC13990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 90 ± 10 aa |
| Standard deviation of domain lengths | 9.97 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 62.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F9EH70 | 1-79 | MRRLIDSLKQAVPDGLEEIQTLAKTLISRSQDVLAYFDQPRTSNGPTEAINGRLEHLRGIALGFRNLTHYTTRSLIHAG |
| A0A1Q3DPS8 | 2-88 | GNKREAKKKMRTIIDQLRVLKGPNKELAQLGRSLFKRLGDVLAYFDVGVSNGPVEAINGRLEHLRGIALGFRNLNHYILRCLIHSGQ |
| A0A2N5IYT7 | 1-83 | None |
| A0A0M2HQ60 | 6-106 | None |
| A0A160VJC5 | 6-106 | None |
| A0A4R6KT22 | 1-90 | None |
| W4A8I3 | 85-185 | None |
| P71641 | 53-125 | None |
| A0A7D7L0B4 | 71-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.