DPCstruct | MC1399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 173 ± 17 aa |
| Standard deviation of domain lengths | 17.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I0F7S2 | 11-179 | LRIAGVSRTQNALVVRYSLHGEGKAPVWVLDQLFRSSPAGHYHLEPERAYVEARDGVLILSRALRKVPDDVDVESPEVPCVRRLAPA… |
| G2LDB2 | 16-192 | CDLRGDVLKAGVHDGITYPCDHLVVTYTLENRAAVPCYVFNRGHSNARSTLGYVEQRPDGVVELSQKACLPPPDCPPTYAPVLPRVS… |
| A0A1G2YY14 | 36-248 | None |
| A0A7Y5U8Y6 | 2-180 | None |
| A0A7T8MTK9 | 115-284 | None |
| A0A179B1P3 | 3-143 | None |
| A0A7X7JQR7 | 7-187 | None |
| A0A0S2FGE6 | 37-212 | None |
| A0A512CWL3 | 51-238 | None |
| A0A4Z1R0C8 | 10-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.