DPCstruct | MC13989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 133 ± 10 aa |
| Standard deviation of domain lengths | 9.99 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 46.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G2R360 | 2-119 | ASIIARRAFSTTVRRLATSEEALKTESKKNPEIMILGGVMVCAIAGAGFYFGRSPTKSTSESPVPLAKNSMPWEAGSGQGKYQYYPG… |
| K1XLN9 | 52-196 | DEHLERHSSKPDHHQFINALDTMRPTIMRAAAQAAKAAKGAETDVLKKGAKRDPELFILGGIMTGALGLAGYYFGRKPTSSTSEAKV… |
| A0A0F8UA69 | 41-171 | None |
| A0A2S7PLT0 | 1-136 | None |
| A0A0E9NLG1 | 34-162 | None |
| A0A151GV59 | 42-191 | None |
| W9P5S7 | 25-170 | None |
| D4ASS4 | 24-140 | None |
| A0A1V6TU71 | 106-237 | None |
| C1GFP4 | 15-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.