DPCstruct | MC13986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 173 ± 28 aa |
| Standard deviation of domain lengths | 27.74 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383UQ51 | 25-163 | KPAAKTVSQAAVNLASDANTVTDALNKLPTLSKREDIQSISQLAIDAESDEDTHRTILATAAGFSGRISNEKLLTYGPTVLRGLKAI… |
| K1WJC8 | 143-299 | SNSPNASGGAGVVGGTKPNADAVSYAAGAFANDAQTVSRSLNTLGSETDPETIRNVAATAFQAESDEDQRRNVLATMAGSAGAQSNS… |
| A0A2S4PTP1 | 28-220 | None |
| J3NPS2 | 41-207 | None |
| A0A6S6UZM1 | 27-191 | None |
| A0A507CN78 | 57-215 | None |
| A0A517LH71 | 1-237 | None |
| A0A168FVU1 | 2-210 | None |
| A0A0F4GNC6 | 86-287 | None |
| A0A074VLT3 | 1-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.