DPCstruct | MC13982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 78 ± 6 aa |
| Standard deviation of domain lengths | 6.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 38.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420ARP4 | 45-121 | MEIPNQISAVANIILKDWKKPYFGAVPYLNTMVQLDNINQMYDQDSAKSIVRYFLANAQSWKGETARAVKAKLNQLL |
| A0A1Q3S3X1 | 4-77 | PNQISAIEKIIRQDWKKIYYAATPYLDAMRELDSIRQNYYEEPAASIVRYFLANATSWRGDTARAVKAKLKQLL |
| A0A0F9YN29 | 65-137 | None |
| A0A1G2JKM5 | 56-136 | None |
| A0A7J2RCU1 | 17-90 | None |
| A0A3N4QB22 | 1-84 | None |
| A0A0F9IYJ4 | 17-91 | None |
| A0A2D6L7K5 | 164-237 | None |
| A0A522DJY0 | 45-124 | None |
| A0A7C9BPA6 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.