DPCstruct | MC13980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 555 ± 54 aa |
| Standard deviation of domain lengths | 53.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.94 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0198- PF14791- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C0GJM0 | 1-508 | MHNRDVAEMLDRAARILALRGENRYRVRAYKRAARAVISAPEEIEQLIRKNRLQSLEGVGSGLAAKIKEIVRTGKLPLLERLETGKL… |
| A0A2E7GGC6 | 200-735 | PSRYRKMLELLEQISEYMKLAGENPFKIKAFDKAYSILSERKDAMDRINAGTLMELDGIGKGINEVVTEFVKTGKSTTLTELQKGLP… |
| A0A101IMP1 | 198-733 | None |
| A0A662PC79 | 1-538 | None |
| A0A0D6QLV5 | 1-546 | None |
| A0A518K674 | 1-688 | None |
| A0A836U6F3 | 17-509 | None |
| A0A3E0KP37 | 2-572 | None |
| A0A535RU75 | 117-698 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.