DPCstruct | MC1398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 124 ± 16 aa |
| Standard deviation of domain lengths | 16.18 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0L5R6 | 28-152 | SPQDQKKDDAVFPQRNCTYIWTVPEDHSPTDDDPNCLTWIYHSHIDAPRDIASGLIGPLLPYKTGMLTGSSQRRWDVHVDFFLMFSV… |
| F2U209 | 288-420 | APYADNSTAGDAIAPGETYTYTWEVPEQSGPGPMDGSSVAWMYHSHVDEPRETNAGLIGVIIITARDKANADATPADVDRELVAGFF… |
| A0A643BMZ6 | 229-341 | None |
| M3XTN0 | 1-94 | None |
| A0A1S3G955 | 229-373 | None |
| A0A1X6PK58 | 141-285 | None |
| A0A7F8R2X7 | 67-206 | None |
| A0A2R2MS47 | 32-146 | None |
| A0A3M9ZYE7 | 193-333 | None |
| A0A1S3M5Y7 | 40-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.