DPCstruct | MC13979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Standard deviation of domain lengths | 10.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10704 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A419SUE2 | 2-79 | NIIYNIRNKFKTPKKDNHDNDDFLKALDEAHKEWKDAENYFKNVTDNDLIDYAIYEMKAARKKYIYLLKEAKRKGIKV |
| C0GJ89 | 14-107 | WETVVSKLSMSEAAATTPQEKDLFDLVEDARQEWQAAMSHFNQVTDPDLVDHAIHAMEAAEKKYTYLLKKARREGYRLPATLDALRE… |
| A0A350BEE8 | 61-132 | None |
| A0A847QG50 | 4-78 | None |
| A0A7X8WXC8 | 14-105 | None |
| F7NN73 | 13-88 | None |
| A0A7C7D282 | 5-114 | None |
| A0A1V5PDS7 | 35-128 | None |
| A0A7C6KM63 | 13-90 | None |
| A0A7C7DN48 | 39-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.