DPCstruct | MC13978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 5.55 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 38.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20501 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A520KN32 | 5-86 | ISMILVGIVGAVMAVAVADMPDFGYPDSPASTHVSPTYILEAYDVAGVHNIVTAVLVYWRAYDTFGEITVIFVAGIAIMALL |
| C0GJ35 | 6-92 | NVLIVLLLVLIGYMLLMTVSEIPPYGEVDVPANNYVPQRYVEQGYEETGGHNLVANIIVAYRAYDTLVEITVLFVAVIAIFLCLKTG |
| A0A7X5VRJ3 | 58-148 | None |
| A0A7V9PKZ7 | 1-79 | None |
| A0A2D6HE49 | 57-150 | None |
| A0A0P8W4B3 | 1-88 | None |
| A0A1Y4LSS9 | 108-191 | None |
| A0A8B2QUE3 | 1-86 | None |
| A0A2V2EYX6 | 1-102 | None |
| A0A3B0Y144 | 74-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.