DPCstruct | MC13977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 143 ± 13 aa |
| Standard deviation of domain lengths | 12.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 24.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09578 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E0QZR6 | 12-143 | SLQVQFLTLAYVALAGIGMGAAFDGYRVAARELNAGRLWIPVFDLLYWLLATLVVFRVLLTVNEGEVRLPVFLGFFIGLAFYFWLLS… |
| C0GIZ8 | 6-155 | IAQQVHTFALTIMLGLLIGLGYDMLRAVKRFIRFSRGMQFIVDFLFWLSVTVMVFLALLASNWGEVRMYVFIGLGTGGIFYTLILSR… |
| A0A1C6IHB7 | 1-162 | None |
| A0A7C7DVU9 | 1-143 | None |
| A0A372LAE3 | 1-129 | None |
| A0A6S6XR41 | 6-143 | None |
| A0A7C6QLL2 | 4-132 | None |
| A0A1H0A9R6 | 31-171 | None |
| C8W320 | 4-167 | None |
| A0A316LFJ8 | 49-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.