DPCstruct | MC13975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 213 ± 40 aa |
| Standard deviation of domain lengths | 39.87 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 44.82 |
| Pfam Score | 93.29 |
| Assigned Pfam label(s) | CL0328- PF00124- PF00421- PF05695 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0TH83 | 69-310 | IGLNMLASVDWDVVQFIRQLPWLALEPPPPSAGLSIPTLQEGGWWLMAGFFLTASVILWWIRTYRRARALKMGTHVAWAFASAIWLY… |
| A0A2L1K3P2 | 29-251 | PLYVGFFGVTTVFFSALGTGLILWGAALGPTWNIWQISIAPPDLSYGLGLAPLREGGLWQLITICALGAFVSWALRQVEISRKLGMG… |
| A0A4S8I8D8 | 42-305 | None |
| A0A835IZ33 | 8-233 | None |
| B9RRG9 | 2-188 | None |
| A0A0E0JUB3 | 1-174 | None |
| A0A2G3BHD9 | 2-152 | None |
| A0A2I8BIJ1 | 2-263 | None |
| A0A2G2XBZ1 | 1-263 | None |
| A0A8A5RCG2 | 1-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.