DPCstruct | MC13972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 176 ± 33 aa |
| Standard deviation of domain lengths | 32.53 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00813 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9NSU1 | 1-145 | MEPVFSEAWEAGIQPMVEETLDVEPALERALVPFRSFMAARLDADTFQAMAALRPDGTQMQLSPEAPLSVLMPSFMLSEIARAFQIG… |
| A0A2D9T6P3 | 20-194 | PSGIIISGLSVILTLCVMTPVGQEIAEVAGPAAARVNVDDPLEGDSYDALLEAIDAGKEPLKAFLKRNAGGREIVLFVDLARQVRDP… |
| A0A1B0C1P8 | 1-139 | None |
| A0A1A9UKN0 | 1-140 | None |
| A0A489FML9 | 261-401 | None |
| A0A1W6YYH9 | 33-268 | None |
| A0A261WH31 | 32-217 | None |
| A0A5B8XSH9 | 43-243 | None |
| A0A3L7SL40 | 359-556 | None |
| A0A2N2H0E5 | 12-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.