DPCstruct | MC13971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 208 ± 23 aa |
| Standard deviation of domain lengths | 22.89 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9CE61 | 2-198 | IYIKQIESLENSFGDTVNLDPLPPFHLIPLDINTVNKAAKKIGEYIGLGKYIFVVNNKRLDEKTGAHIELQHEENYVFLEISENLDN… |
| A0A2D9T649 | 6-224 | GFIRWLLWAWERLLRLEGGTEDFRRRRRLVVPVAENFPVDPGLEGHDLADDYFLFVKEHAGVQGWPLELVPEDGWADDDDLGVPYDP… |
| A0A2E6YBS3 | 27-231 | None |
| A0A6B2TVV3 | 37-262 | None |
| A0A7C5J555 | 10-243 | None |
| A0A496STX0 | 114-327 | None |
| A0A661NJA2 | 9-241 | None |
| A0A3N1KT12 | 1-164 | None |
| A0A1M5UGI8 | 17-208 | None |
| A0A1N6KMH0 | 1-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.