DPCstruct | MC1397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 190 ± 26 aa |
| Standard deviation of domain lengths | 25.72 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 43.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A670ZEH1 | 2-181 | RMRTLVFPSQTVINYSALELADMFMTNRQKPGERLSQWLVRMWDQGATSLHLTGKELVKLGALSEDTLINQYLSSRNVADAGSLFDW… |
| A0A3M0L558 | 191-367 | TKGDISISTQTITEAEQPKPVAVAPVQKKKSKSKSVCIVTDEDVAGPSHPAEETEPEIITCSLSLGELCDLRREFTRQTNESILTWL… |
| A0A3M0IRL3 | 45-261 | None |
| A0A3M0IQ43 | 197-413 | None |
| A0A3M0IJT1 | 81-298 | None |
| A0A3M0IHY4 | 1-167 | None |
| I3NG53 | 2-132 | None |
| A0A3M0L8F4 | 129-259 | None |
| A0A669QH04 | 267-477 | None |
| A0A2Z4LKT2 | 180-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.