DPCstruct | MC13968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 46 ± 4 aa |
| Standard deviation of domain lengths | 4.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 55.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17653 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A370JWE9 | 1-38 | MLREGEDYYLEGGLWVFTESYHLKRGYCCGSGCRHCPY |
| A0A285M9N4 | 1-43 | MEEGDFYLSEEGYKVFTKQYHLKRGYCCESGCRHCPYGYDKKT |
| A0A6C0GF48 | 13-54 | None |
| A0A397SWX0 | 51-95 | None |
| A0A2K4X628 | 24-65 | None |
| A0A3M9MX94 | 1-48 | None |
| A0A2K2ZEX2 | 28-74 | None |
| A0A4P8RK43 | 20-65 | None |
| W2UIT7 | 27-66 | None |
| A1ZF07 | 1-45 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.