DPCstruct | MC13967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 143 ± 25 aa |
| Standard deviation of domain lengths | 24.87 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 15.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A239D399 | 4-95 | YSGIETRLLDGDLVQFEVEMRGARNAADVEDYAECAAAQYALIRGYGFARHLRTTAYEEGGLWRGDAVYTISAALPRGLKTIDAEVA… |
| A0A448KUU6 | 12-150 | CGLLLIGLLSGCATPYDSEKSFWNGRTGFSQTQLGTDRWQLEFVGNELVDRETARKYVLKRAGEMALALGYAWVQVHELSVSRDAVR… |
| A0A258GLV8 | 8-121 | None |
| A0A832DXY9 | 50-220 | None |
| A0A2V6ERN0 | 17-148 | None |
| A0A2N0WQU8 | 5-144 | None |
| A0A561JYK2 | 4-184 | None |
| A0A0J0ZKD1 | 1-119 | None |
| A0A1V5BHI6 | 3-188 | None |
| A0A318AS61 | 3-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.