DPCstruct | MC13965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 295 ± 58 aa |
| Standard deviation of domain lengths | 58.39 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 73.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.94 |
| Pfam Score | 89.05 |
| Assigned Pfam label(s) | CL0023- PF02272- PF01018- CL0127- PF09269 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814TJS0 | 19-164 | LNLPFIDKLRVYVRGGRGGNGLKKYGGIGGQGGHVLVHGKRNLTLKNVYEKNLAKRYIASDGEHSYKTCLNAQSGENLIIHVPLGIQ… |
| A0A0G1VJH6 | 1-301 | MVPREGLEPSRDCSHAILSRARMPVPPPGQAKKRVYYIRFMFCDEVTVQFNAGRGGNGCVGFRREKFVPYGGPNGGDAGKGGSLYLM… |
| A0A0F8ALW7 | 590-950 | None |
| A0A0K0EK14 | 1885-2200 | None |
| A0A7Y4ZGZ5 | 1-309 | None |
| A0A2H6K9W1 | 124-340 | None |
| A0A5J4YLG7 | 160-504 | None |
| A0A6J5W0C7 | 2-217 | None |
| A0A5F5XVZ4 | 224-536 | None |
| A0A3S3Q0V8 | 116-457 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.