DPCstruct | MC1396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 162 ± 38 aa |
| Standard deviation of domain lengths | 38.24 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 74.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 43.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF17687- CL0027- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0IRL3 | 185-314 | VRDRYLCKEDLQVHQGKWSTMEQGTRCLRELAVLEIIFSEDERFPKSPDDVQCTSQMWLRFARLGPEMYSRYLATLQWREGEDKVGV… |
| A0A3M0L3G6 | 194-387 | RTQQTLSLWRRLLTSVRDRYLCKEDLQVHQGKWSTVEQSIQCLRELAVLEIIFSEDERFPKSPDDVQCTSQMWLRFARLGPEMYSRY… |
| A0A3M0IY66 | 23-198 | None |
| A0A3M0ISP0 | 2-164 | None |
| A0A3M0IUJ6 | 234-347 | None |
| A0A3M0ITS6 | 478-633 | None |
| A0A3M0ISQ4 | 258-426 | None |
| A0A3M0LA92 | 106-302 | None |
| A0A3M0IP42 | 1-150 | None |
| A0A3M0IJT1 | 183-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.