DPCstruct | MC13958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 197 ± 35 aa |
| Standard deviation of domain lengths | 35.07 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4J4E7 | 1-131 | MNTSYDPIDSIRSIIETHFNLLRRLKVRQTSKDQITKELLFIVQKVIEFSDNPKLTLRQLGMIIFPGCIAIHKGKIVKLLSLCKSGF… |
| A2GG05 | 7-163 | LSPIDHKQLKSLKELLIGEVLKTKRGINTVVFSKKLELLKDFCIQGSSDDIKRCIACGIIWIPNGVFICVQRLSQLLGKCKSSVNGS… |
| A2FX79 | 13-155 | None |
| A0A1J4JQZ2 | 3-192 | None |
| A0A1J4JF32 | 6-219 | None |
| A0A1J4JBC5 | 48-285 | None |
| A2EYL5 | 6-134 | None |
| A2ER82 | 1-205 | None |
| A2EPX6 | 24-186 | None |
| A0A1J4KVY7 | 1-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.