DPCstruct | MC13955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Standard deviation of domain lengths | 12.01 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A2F2D2 | 5-113 | IQNFEYIAAHIKDYIDENKLFSTFEIQDIKKIMKFTTLTTNDFITLMIQSQSEINANELYTSTRKANVSIQNYEEVVSILKSLNKYM… |
| A2G4H2 | 5-118 | IVRNYEYIGSHIKDYIEENNLFSTFEVEDIKSIMKFANLTPDDFNSLLVKSHSVISARKLYICTRNANISINNLQDAISTLKSVQKY… |
| A2FJ35 | 2-107 | None |
| A2FI62 | 1-114 | None |
| A2FER2 | 1-112 | None |
| A2FXV4 | 5-114 | None |
| A2FCV3 | 1-86 | None |
| A2FA32 | 1-107 | None |
| A2E183 | 1-78 | None |
| A2DNL5 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.