DPCstruct | MC13952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 120 ± 8 aa |
| Standard deviation of domain lengths | 7.86 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850MEW1 | 1-114 | MSKSWESLFSCDKCGEPLAIKVIKGHKDLVTVGKCTKGHKKRFILSISELDEWAPALDPHFFKCVRCDTPVSVTPLHRGPWVKVIVT… |
| A0A850MAT1 | 6-119 | ICSKCRNLFSIEKIVIGKKGRAMFDLVCPKKHTDKQYLNAYLMNDWVPSVARQLYLCPKCGLKLTDISRATDDKKTTLMLNCPTHFK… |
| A0A850MGV3 | 54-166 | None |
| A0A850MFE7 | 1-116 | None |
| A0A850MFE0 | 4-123 | None |
| A0A850MBA1 | 1-132 | None |
| A0A524CLK1 | 4-136 | None |
| A0A842TSF9 | 1-125 | None |
| A0A842TP43 | 58-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.