DPCstruct | MC13951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 580 ± 64 aa |
| Standard deviation of domain lengths | 63.90 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 18.59 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF16076- CL0228 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7UVP7 | 1-570 | MSKAPTNSRSDSGSAAAAVSTEDRESAARVAVPRKLTFNRMASVEARHRSSMLRRFGPLYHLSGLGLLLRRLRLEEHSAENIRRASQ… |
| A0A818EBU4 | 3-634 | FYNELKSSFIIIAFLGYIFLVSGLIINCLQLCSCIIWPFNKELYRKINRYLALGIWSQFTFAAQWWSKSDCALYIKPDDLEKVRKEH… |
| A0A0F8VMM6 | 8-485 | None |
| T1IT00 | 97-774 | None |
| A0A0F9MRE4 | 1-539 | None |
| A0A226NZ33 | 1-583 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.