DPCstruct | MC1395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 490 ± 70 aa |
| Standard deviation of domain lengths | 70.41 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 34.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0KP09 | 1-487 | MPWKPGFKSTKRSDHSNTRLAIQIEKDGGNDDNNLNSIFYEHLTRSLQESLCGDLILGRWGNYNTGDCFILTSDYLNAFVHLIEIGN… |
| A0A6A5HPC1 | 5-421 | FYLNSLVHIIEVGNGFVTFQLRGLEFRGTYCHQREVEAITEDIRDGSGFCCCSPGSLPGFLSFNTAWNLRWLAWEVVSGKYIIDGYS… |
| A0A0R3QU75 | 459-946 | None |
| A0A7J6PDT0 | 486-976 | None |
| A0A7J6PLG8 | 5-426 | None |
| A0A672PTL8 | 282-830 | None |
| A2FIN1 | 77-499 | None |
| A0A151P9C1 | 9-539 | None |
| A0A5S6PFV0 | 1281-1871 | None |
| E9PSU6 | 1496-2026 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.