DPCstruct | MC13949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 157 ± 14 aa |
| Standard deviation of domain lengths | 14.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6X6K9 | 277-428 | WAFQQWNTLSTYLKINADDPYGAVTGVFEHLTQGQGVYRDTYNEGVLREDLTEIPPLWDRLKFGAWYRGAGDVRRVMDDIYVAVGPG… |
| A0A2E5MRH9 | 3-165 | EGSQPDYSGWKGNTGEWNRLELLANSDEGTIKTWTNGELIHSVTNYKKEDTPEGLSIALIGFDPNYADRYSSLVFRMDDIYVSSSPA… |
| A0A2D5EKL7 | 63-221 | None |
| A0A3C1ERE3 | 2-160 | None |
| A0A0F2QQM5 | 182-358 | None |
| D2W455 | 27-186 | None |
| A0A0B5BG24 | 49-207 | None |
| A0A5C6UVH4 | 121-274 | None |
| A0A328C1F3 | 2-140 | None |
| A0A849YZ09 | 89-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.