DPCstruct | MC13940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 282 ± 46 aa |
| Standard deviation of domain lengths | 46.08 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6SFH7 | 236-475 | LIPWHWNVSWSPPSQQSGTSTKRAAETPARPHCPSTGAKLCAFAAVNIAMAIIMPILGRRSVIFFVTFGLLGKPDMHLWWISGILTL… |
| A0A0D2BSG9 | 111-408 | QTDCASTPAELGSFAAINVIVLLVSILLSRRTFVERITFGRCGKAGSSMWILTGFLSFILSVAANFVNALLLNHTPGYGHVPIGSLV… |
| A0A2J6T2V1 | 29-339 | None |
| A0A2T2NRU1 | 26-273 | None |
| A0A0I9XIY5 | 290-604 | None |
| X0KJC8 | 287-603 | None |
| A0A6A6UF66 | 460-820 | None |
| A0A4Z0YHD3 | 478-748 | None |
| G0SFA7 | 8-267 | None |
| A0A4Q4T7U0 | 6-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.