DPCstruct | MC1394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Standard deviation of domain lengths | 12.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 45.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226MAL1 | 29-145 | RIRVELKCMCARERLVGDILCFLHHPKDELREQQKPSLLETLCTGSYLNMDATATWFQELVRVAWVLLPQSDTVELELLPSTRSCKL… |
| A0A3M0KJ96 | 23-123 | EEDMLCFLYHPKEELRRKQDPRLLHTLCTGAYLDVEKTVHWFYRFVRVAWLLLPQSRRWRSMLRPSSCSCKFQLSKDKESFVVEVIF… |
| A0A835NRZ6 | 226-334 | None |
| A0A2I0UG72 | 224-334 | None |
| A0A2I0TYY4 | 1-97 | None |
| A0A2I0TIL1 | 70-153 | None |
| A0A3M0JAE3 | 101-207 | None |
| A0A3M0IU62 | 109-222 | None |
| A0A2P4SQF8 | 69-159 | None |
| A0A2P4SBA7 | 4-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.