DPCstruct | MC13938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 6.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 55.96 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0023- CL0363- PF04810 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9XTH9 | 56-150 | MPHIIISGMPGIGKTTSIHCLAHQLLGDAYKEGVLELNASDERGIDVVRNKIKAFAQKKVTLPSGRHKIVILDEADSMTPGAQQALR… |
| A0A2G2XXN6 | 1-87 | MLFYGPPGTGKTTTALAIAHQLFGPELYKSRVLELNASDNRGINVVRTKIKNFAAVAVGSSRQGGYPCPPFKIVILDEADSMTQDAQ |
| A0A2H5PIF0 | 34-121 | None |
| A0A183P2Z1 | 61-158 | None |
| A0A139WCT5 | 46-125 | None |
| A0A5E4PYZ3 | 48-125 | None |
| A0A094GLM8 | 68-164 | None |
| A0A0V0Q831 | 509-581 | None |
| A0A061RMG9 | 39-123 | None |
| A0A154PQP6 | 68-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.