DPCstruct | MC13937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 5.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 51.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6XDJ2 | 16-84 | IPNEYMLHVSLLFGDFTDEVKQRIIEKAEAFYPNLTSLSFQTSQLALWRTNTDDQTLETWVKVAEYDLV |
| A0A2G2XWP0 | 1-65 | MPHMSLLYADLTDEEKKKAQEKACILDESIGNMSFQITRLALYKADTEDKSLKSWEKIEEYNLSP |
| A0A565AUC3 | 91-163 | None |
| A0A540LRR6 | 74-140 | None |
| A0A835MES7 | 11-86 | None |
| A0A7J7CQJ2 | 504-569 | None |
| M7ZG67 | 90-159 | None |
| A0A5N5H699 | 67-142 | None |
| A0A061GEN8 | 265-336 | None |
| A0A5E4FEM6 | 38-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.