DPCstruct | MC13935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 163 ± 31 aa |
| Standard deviation of domain lengths | 30.93 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 69.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8XS38 | 2-121 | EEFELRKAAARAVTGVLASHPNSTDVHIINMSLTFHGQELLSDTTIELNSGRRYGLIGLNGTGKSMLLSAVGGREVPIPEHIDIYHL… |
| A0A2G2XTF2 | 18-158 | AAKRGGKGAATSKAAAAKVAVAESNEVDNLANGVEDLKISDRTCTGVLCSHPFLRDIRIESLSVTFHGYDLIVYSELDLNYGRCCGL… |
| E4YFR2 | 2-98 | None |
| A0A565AP77 | 96-212 | None |
| A0A183KQI8 | 126-294 | None |
| A0A183KCP5 | 12-206 | None |
| A0A4Y9ZX65 | 73-268 | None |
| A0A6V7NQY4 | 10-167 | None |
| A0A7S3ZUU2 | 583-738 | None |
| K2GZ72 | 141-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.