DPCstruct | MC13933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 154 ± 24 aa |
| Standard deviation of domain lengths | 23.51 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287VSS3 | 21-148 | PINSSLGSSYSVKHLNELFPNRIFMEPPKDEAQLSYLTQQIRLDIGSARAKANVLSIRKFLTQREIECNDVEELLITDRLLTRDDVD… |
| A0A1U8H0G5 | 2-190 | VSIMAKSYLQNNKQSETGGSLFTNLSSTLFDPAFPDSFGEMHDKGKRSARTNKFLINLFPNKVDAALLSTWKQQLDQDVDTLTMKEN… |
| A0A835U7F5 | 3-122 | None |
| A0A287W2Z5 | 89-224 | None |
| A0A3L6SXQ1 | 454-612 | None |
| A0A453HVB5 | 407-577 | None |
| A0A453HVA0 | 563-736 | None |
| A0A453HVA5 | 193-368 | None |
| A0A453HUR5 | 128-296 | None |
| A0A2G3CBB2 | 7-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.