DPCstruct | MC1393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 490 ± 79 aa |
| Standard deviation of domain lengths | 79.48 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.63 |
| Pfam Score | 86.07 |
| Assigned Pfam label(s) | CL0648- CL0063- CL0154- CL0027- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0KDK2 | 12-496 | NAALFKVDRTEVIRTCINPVFSKLFTVDFYFEEVQRLRFEVHDISSNHNGLKEADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGKS… |
| A0A672NQZ5 | 1-345 | MMVHRTEVIKNTLDPVWKPFTVPLISLCNGDVDRNIKVLCYDYDNDGGHDFIGEFQTTVNKMSEAQNGVEVEFDCINPKKQKKKSYK… |
| A0A671N6Q4 | 2-358 | None |
| A0A0V0W882 | 646-1038 | None |
| K1Q8E5 | 22-424 | None |
| A0A6A2YG26 | 18-427 | None |
| A0A5J4Z0Y0 | 629-1183 | None |
| R7QI63 | 163-704 | None |
| A0A0V0QR43 | 33-547 | None |
| A0A3B5PU18 | 11-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.