DPCstruct | MC13928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 404 ± 63 aa |
| Standard deviation of domain lengths | 63.46 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.10 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | PF04968- CL0033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U4UF21 | 223-543 | GYFAEVTLGQKLEDMDISVHCDIGIFEWLMQWVKKDSLLEADWPHLDSQCVIPILVSAAFLQMEPLLQDCLLFCHQHMNEILRTASN… |
| A0A821QIV4 | 5-356 | RFHPEASQITITVCDEAKILKRQFSCNRSLLIREMRYFADYLKDEPDQAEEVDISVHCDLDIFQWLMSFVNRRSATKEPDLEPRIAV… |
| A0A183R4S2 | 15-398 | None |
| R7TPZ6 | 28-359 | None |
| A0A6J3C0S6 | 239-695 | None |
| A0A834M6B2 | 1-339 | None |
| A0A7J7QCG0 | 3-354 | None |
| A0A812JPC2 | 4-363 | None |
| A0A7I8VY82 | 125-560 | None |
| A0A672KCF6 | 26-487 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.