DPCstruct | MC13927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 191 ± 20 aa |
| Standard deviation of domain lengths | 19.64 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0TNP9 | 27-224 | TQILFSSFFSAYYACFLPLVFVQTYVVYEEHWVLMHFPFVMMTMGMMLCIHYYPVKYFDHLHKAAMHLGRWKRVKLDRPHLPIHLWS… |
| A0A821PSD2 | 11-188 | QPLKFLITLFTLSTFITHSAFLFPVKLQTTLHRIAAHLGQWRQQSNIRTDTINEWSSECNSYTRGSVIKLPSNHQYYIAIQHLSNAA… |
| A0A2H2HZI2 | 447-634 | None |
| A0A139WAV5 | 574-749 | None |
| A0A0R3TMJ8 | 4-157 | None |
| A0A3M0J9B9 | 777-958 | None |
| B7G3U2 | 271-461 | None |
| A0A1I7W6F7 | 261-461 | None |
| A0A674D6U7 | 495-667 | None |
| A0A067D2D2 | 135-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.